GRS - Gmod Report System - Chado Genome Report

Gene Report

ACYPI005585

mRNA Name	Scaffold	Start	Stop	Strand
XM_001951587	EQ122773	292798	305902	PLUS

>XM_001951587_mRNA
gtagaacttttcacccggacgacacagtcacactcaggacgacggtccatcaacacctgcagtgctccgccatcgcggtttagaccggacggtacctgcc
tataccaacctgataccatctttgtgcaccgtggggtttattccgcgcacacacacacgcccgacgatttaaactgtaaacaaaaaccccatcgcgaatt
gacgacaacaggataatatttcacacacgtccaagacataatatatacgaaagtttacgcctcattcgccgtcgcccgtcttataacggcacgtcaaacc
accgggtgacacacggacgtgtcattttaatattattatataataatatattatcgaaaagttcgctccgtagctatgtacagattccaagacgtagccc
gtccagcggcgacggcggccaaacattttgtcggcgcaccactgagaatggcatcatcaatttgtcccggagaatatgctgcaccgtcggtcgaaacgtc
agtaccaggaccgaagtcaaaaaaactacttgctgatctttcacaaatgcagcaatctggttcggttcagctattcgctgactataacaaatcactggga
aactacttggttgacgttgacggtaacgttctgttggacgtgtacacgcaaatttcgtcattgccgttgggttacaaccacccggacatgttgaaagtat
tggacagcgatgagaacaaaagagccatcgtcaatcgtccggcgttgggtgtgttcccagctgccgattggccagtgaaactacgagacacacttatgag
tgtcgcacctaaaggtatggactctctaacgaccatgatgtgtgggtcttgttccaacgagaacgcgtacaaaaatatgttcatgaagtaccagcgggat
aaaaggggaggcacttcggacttcacagacttagagaaggagtcatgcatgattaacatgccgccaggcgcacccaagctatctatactgtcgttcaagg
gttcgttccacggccgcacactgggcgtcctatctaccacgcattctaagtacgtgcacaagttggacgtgcccgcgtttgactggccaatggcaagatt
ccccgagtacaagtatccgctgcatgagaacctcaaggaaaatgaacaagaagacgaacgttgcttggctgaagtggaggaactgatagagaagtgggaa
aagaagggcaaccccgtggccggaatcgtcgtggagcccatccaggcggaaggcggagacaaccacgcatcgccttatttcttccagaaacttcagaaga
ttgccaaaaagtacaacgcgggatatctaatcgacgaggtgcagacaggcggcggccccaccggtaaaatgtggtgtcacgagcatttcgatctggaaac
ttcgcccgacatcgttacttttagcaagaaaatgcagaccggtggatactacttgaagaaggaattcttacccgacttgccgtaccgtgtgttcaacact
tggatgggagatccgaccaaaatcgtattgctcgatgctatattgaaggtgatcaagagagaaaatctgttgtcggtggtcgaaaagtccggcgatgtac
tcatgtccggactcagagacttggaagccgagttcccagcactaatcaactccaccagaggccgcggtacattcataacgttcgatgctgctgacgcaaa
actccgagacgacatcgtcaaaagacttttagccaaaggagtccaatccggaggatgtggagtagtgggtattagaatgcgaccggcgttgatctttcaa
ccacatcacgctcacatgttcaatgacagacttcgccaggtgttggtcgaaactaaataggttacacgttatattgtacaactattatacgcgtgtagta
tgagcatttgtttataatattgtgatattatcgaaaaatatgtcttccaattttaacataaagctttttaaaaatgaacgtaaacaagtcttccaaaata
ttttacacaattattacgaatattgaattgtatgtaattaattacaaagtagatattatatagtgctattttatgttactgttattattttacgttttat
tataatatttattataatttatacttatttaataatatttatgataatttatattttatgctaaggtaaaacgagtgcttccaaatgttttaatgttatc
gctaacggatcgcatattgtgttccatttacgtgagttcaaaaattttgttaaaatataatacataaaatacataaaattataataactatgtatatcgt
tttttgtgtatggtatattctcattgaataaaataaaaaaatttaggtaaaaacttgaaaaaaa

>XM_001951587_prot
MYRFQDVARPAATAAKHFVGAPLRMASSICPGEYAAPSVETSVPGPKSKKLLADLSQMQQSGSVQLFADYNKSLGNYLVDVDGNVLLDVYTQISSLPLGY
NHPDMLKVLDSDENKRAIVNRPALGVFPAADWPVKLRDTLMSVAPKGMDSLTTMMCGSCSNENAYKNMFMKYQRDKRGGTSDFTDLEKESCMINMPPGAP
KLSILSFKGSFHGRTLGVLSTTHSKYVHKLDVPAFDWPMARFPEYKYPLHENLKENEQEDERCLAEVEELIEKWEKKGNPVAGIVVEPIQAEGGDNHASP
YFFQKLQKIAKKYNAGYLIDEVQTGGGPTGKMWCHEHFDLETSPDIVTFSKKMQTGGYYLKKEFLPDLPYRVFNTWMGDPTKIVLLDAILKVIKRENLLS
VVEKSGDVLMSGLRDLEAEFPALINSTRGRGTFITFDAADAKLRDDIVKRLLAKGVQSGGCGVVGIRMRPALIFQPHHAHMFNDRLRQVLVETK

Exon	Start	Stop	Strand
ACYPI005585-RA-E1_0	292798	293240	PLUS
ACYPI005585-RA-E2_0	297524	297634	PLUS
ACYPI005585-RA-E3_0	298362	298530	PLUS
ACYPI005585-RA-E4_0	299136	299217	PLUS
ACYPI005585-RA-E5_0	301200	301572	PLUS
ACYPI005585-RA-E6_0	302339	302477	PLUS
ACYPI005585-RA-E7_0	302567	302725	PLUS
ACYPI005585-RA-E8_0	302831	303100	PLUS
ACYPI005585-RA-E9_0	305276	305902	PLUS

Similarity

Transcript alignments

organism	tissue_type	clone_lib	Start	End	Strand	Name
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292798	298530	+	EX618122
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292817	298530	+	EX648541
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292818	293240	+	FF326507
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	293240	+	FF309588
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	293240	+	FF321139
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	299161	+	EX607058
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	299187	+	EX602803
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	299192	+	EX629113
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292819	299200	+	EX612407
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292820	293240	+	FF323247
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292820	293240	+	FF328994
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292820	298500	+	EX637471
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292820	298516	+	EX616806
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292821	293240	+	FF294842
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292821	293240	+	FF313650
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292821	298530	+	EX641576
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292822	299184	+	EX634359
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292822	299219	+	EX630160
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292823	298533	+	EX654172
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292824	293240	+	FF337559
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	292824	299197	+	EX624502
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	302920	305832	-	EX635608
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	302929	305828	-	EX613035
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	302953	305828	-	EX654316
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	302955	305832	-	EX606391
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305269	305826	+	FF322185
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305796	+	FF295153
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305796	+	FF311189
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305796	+	FF314801
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305796	+	FF325475
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305827	+	FF329889
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305828	+	FF328154
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305274	305828	-	EX621298
Acyrthosiphon pisum	Whole body, nymphs and adults, winged and wingless	Pea aphid whole body normalized full length cDNA library	305482	305825	-	EX649480
Acyrthosiphon pisum	digestive track	ApDT	292821	293082	+	CN750011
Acyrthosiphon pisum	digestive tract	ID0AAG	301242	303055	+	DV744718
Acyrthosiphon pisum	digestive tract	ID0AFF	301294	301584	+	DV741374
Acyrthosiphon pisum	digestive tract	ID0AFF	302831	305497	+	DV738673
Acyrthosiphon pisum	whole insect	ApMS	301195	301584	+	CN761224

Summary of organism

value	Number	frequency
Acyrthosiphon pisum	39	1.0

Summary of tissue_type

value	Number	frequency
whole insect	1	0.025641026
Whole body, nymphs and adults, winged and wingless	34	0.8717949
digestive track	1	0.025641026
digestive tract	3	0.07692308

Summary of clone_lib

value	Number	frequency
Pea aphid whole body normalized full length cDNA library	34	0.8717949
ID0AFF	2	0.051282052
ID0AAG	1	0.025641026
ApDT	1	0.025641026
ApMS	1	0.025641026

Protein Similarities

query_name

analysis

hit_name

description

interpro_id

positions

OtherProperties